| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
| Protein automated matches [190197] (23 species) not a true protein |
| Species Fungus (Coccidioides immitis) [TaxId:5501] [189368] (1 PDB entry) |
| Domain d3n7ta_: 3n7t A: [181978] automated match to d1qvvb_ complexed with cl, edo, po4 |
PDB Entry: 3n7t (more details), 2.1 Å
SCOPe Domain Sequences for d3n7ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n7ta_ c.23.16.0 (A:) automated matches {Fungus (Coccidioides immitis) [TaxId: 5501]}
plprkallaitsahppfwpdgkrtglffsealhpfneltaagfevdvasetgtfgwdehs
ltqeylskedekvlhsehnhfmekmnkqvfkagdlaphdyglmfvcgghgalydfphakh
lqniaqdiykrggvigavchgpamlpgihdengdsvikdktvtgfttkgeimikvidkmr
edhlhtiadmaqtanaeyvppedpwddfckvdgrivtganpqsatntardtikvyegivn
e
Timeline for d3n7ta_: