Lineage for d3n7oa_ (3n7o A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2388012Protein Chymase (mast cell protease I) [89343] (1 species)
  7. 2388013Species Human (Homo sapiens) [TaxId:9606] [89344] (13 PDB entries)
  8. 2388016Domain d3n7oa_: 3n7o A: [181977]
    automated match to d1pjpa_
    complexed with n7o, unl

Details for d3n7oa_

PDB Entry: 3n7o (more details), 1.8 Å

PDB Description: X-ray structure of human chymase in complex with small molecule inhibitor.
PDB Compounds: (A:) Chymase

SCOPe Domain Sequences for d3n7oa_:

Sequence, based on SEQRES records: (download)

>d3n7oa_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqfnfvppg
rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
dsggpllcagaaqgivsygrsdakppavftrishyqpwinqilqan

Sequence, based on observed residues (ATOM records): (download)

>d3n7oa_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsfvppgrmc
rvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkgdsg
gpllcagaaqgivsygrsdakppavftrishyqpwinqilqan

SCOPe Domain Coordinates for d3n7oa_:

Click to download the PDB-style file with coordinates for d3n7oa_.
(The format of our PDB-style files is described here.)

Timeline for d3n7oa_: