| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) ![]() this domain interrupts the G-protein common fold |
| Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
| Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [47898] (15 PDB entries) |
| Domain d1taga1: 1tag A:57-177 [18197] Other proteins in same PDB: d1taga2 complexed with gdp, mg |
PDB Entry: 1tag (more details), 1.8 Å
SCOP Domain Sequences for d1taga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1taga1 a.66.1.1 (A:57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
ysleeclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmp
kemsdiiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvk
t
Timeline for d1taga1: