Lineage for d1tag_1 (1tag 57-177)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) 
Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) Protein Transducin (alpha subunit), insertion domain [47897] (2 species) 
Species Cow (Bos taurus) [TaxId:9913] [47898] (11 PDB entries) 
Domain d1tag_1: 1tag 57-177 [18197]
Other proteins in same PDB: d1tag_2
Details for d1tag_1
PDB Entry: 1tag (more details), 1.8 Å
PDB Description: structural determinants for activation of the alpha-subunit of a heterotrimeric g protein
SCOP Domain Sequences for d1tag_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tag_1 a.66.1.1 (57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus)}
ysleeclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmp
kemsdiiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvk
t
SCOP Domain Coordinates for d1tag_1:
Click to download the PDB-style file with coordinates for d1tag_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tag_1:
- d1tag_1 first appeared (with stable ids) in SCOP 1.55
- d1tag_1 appears in SCOP 1.59
- d1tag_1 appears in the current release, SCOPe 2.08, called d1taga1
View in 3D
