Lineage for d3n7ae_ (3n7a E:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2116843Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2116844Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 2116958Protein automated matches [190071] (5 species)
    not a true protein
  7. 2117027Species Mycobacterium tuberculosis [TaxId:1773] [189947] (16 PDB entries)
  8. 2117059Domain d3n7ae_: 3n7a E: [181957]
    automated match to d1h05a_
    complexed with fa1, gol

Details for d3n7ae_

PDB Entry: 3n7a (more details), 2 Å

PDB Description: Crystal structure of 3-dehydroquinate dehydratase from Mycobacterium tuberculosis in complex with inhibitor 2
PDB Compounds: (E:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d3n7ae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n7ae_ c.23.13.1 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
gvivglgiqgyllalrylaeh

SCOPe Domain Coordinates for d3n7ae_:

Click to download the PDB-style file with coordinates for d3n7ae_.
(The format of our PDB-style files is described here.)

Timeline for d3n7ae_: