| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) ![]() this domain interrupts the G-protein common fold |
| Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
| Protein Transducin (alpha subunit), insertion domain [47897] (2 species) |
| Species Cow (Bos taurus) [TaxId:9913] [47898] (11 PDB entries) |
| Domain d1tadb1: 1tad B:57-177 [18195] Other proteins in same PDB: d1tada2, d1tadb2, d1tadc2 |
PDB Entry: 1tad (more details), 1.7 Å
SCOP Domain Sequences for d1tadb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tadb1 a.66.1.1 (B:57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus)}
ysleeclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmp
kemsdiiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvk
t
Timeline for d1tadb1:
View in 3DDomains from other chains: (mouse over for more information) d1tada1, d1tada2, d1tadc1, d1tadc2 |