Lineage for d3n6qe_ (3n6q E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2081379Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2081380Protein automated matches [190793] (26 species)
    not a true protein
  7. 2081435Species Escherichia coli [TaxId:668369] [189989] (1 PDB entry)
  8. 2081440Domain d3n6qe_: 3n6q E: [181947]
    automated match to d1exba_
    complexed with mg

Details for d3n6qe_

PDB Entry: 3n6q (more details), 1.8 Å

PDB Description: Crystal structure of YghZ from E. coli
PDB Compounds: (E:) YghZ aldo-keto reductase

SCOPe Domain Sequences for d3n6qe_:

Sequence, based on SEQRES records: (download)

>d3n6qe_ c.1.7.0 (E:) automated matches {Escherichia coli [TaxId: 668369]}
vwlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithfd
lannygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasld
qslkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmvel
lrewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltgkylngipqd
srmhregnkvrgltpkmlteanlnslrllnemaqqrgqsmaqmalswllkddrvtsvlig
asraeqleenvqalnnltfstkelaqidqhiadgel

Sequence, based on observed residues (ATOM records): (download)

>d3n6qe_ c.1.7.0 (E:) automated matches {Escherichia coli [TaxId: 668369]}
vwlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithfd
lannygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasld
qslkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmvel
lrewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltgkeanlnslr
llnemaqqrgqsmaqmalswllkddrvtsvligasraeqleenvqalnnltfstkelaqi
dqhiadgel

SCOPe Domain Coordinates for d3n6qe_:

Click to download the PDB-style file with coordinates for d3n6qe_.
(The format of our PDB-style files is described here.)

Timeline for d3n6qe_: