Lineage for d3n6kf_ (3n6k F:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014347Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2014348Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2014349Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)
  6. 2014394Protein automated matches [190489] (5 species)
    not a true protein
  7. 2014395Species Human (Homo sapiens) [TaxId:9606] [187688] (78 PDB entries)
  8. 2014446Domain d3n6kf_: 3n6k F: [181939]
    automated match to d1fpsa_
    complexed with bfh, po4

Details for d3n6kf_

PDB Entry: 3n6k (more details), 2.25 Å

PDB Description: human fpps complex with nov_823
PDB Compounds: (F:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d3n6kf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n6kf_ a.128.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvvafr
elveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgldai
ndanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvrft
ekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyldlf
gdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyeeld
lpavflqyeedsyshimalieqyaaplppavflglarkiyk

SCOPe Domain Coordinates for d3n6kf_:

Click to download the PDB-style file with coordinates for d3n6kf_.
(The format of our PDB-style files is described here.)

Timeline for d3n6kf_: