Lineage for d1dk5b_ (1dk5 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1738953Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 1738954Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 1738955Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 1739045Protein Plant annexin-like protein [47892] (2 species)
  7. 1739046Species Bell pepper (Capsicum annuum) [TaxId:4072] [47893] (1 PDB entry)
  8. 1739048Domain d1dk5b_: 1dk5 B: [18193]
    complexed with so4

Details for d1dk5b_

PDB Entry: 1dk5 (more details), 2.8 Å

PDB Description: crystal structure of annexin 24(ca32) from capsicum annuum
PDB Compounds: (B:) annexin 24(ca32)

SCOPe Domain Sequences for d1dk5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dk5b_ a.65.1.1 (B:) Plant annexin-like protein {Bell pepper (Capsicum annuum) [TaxId: 4072]}
hmasltvpahvpsaaedceqlrsafkgwgtnekliisilahrtaaqrklirqtyaetfge
dllkeldrelthdfeklvlvwtldpserdahlakeatkrwtksnfvlvelactrspkelv
lareayharykksleedvayhttgdhrkllvplvssyryggeevdlrlakaeskilheki
sdkaysddevirilatrskaqlnatlnhykdehgedilkqledgdefvallratikglvy
pehyfvevlrdainrrgteedhltrviatraevdlkiiadeyqkrdsiplgraiakdtrg
dyesmllallgqee

SCOPe Domain Coordinates for d1dk5b_:

Click to download the PDB-style file with coordinates for d1dk5b_.
(The format of our PDB-style files is described here.)

Timeline for d1dk5b_: