Lineage for d1dk5a_ (1dk5 A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4582Fold a.65: Annexin [47873] (1 superfamily)
  4. 4583Superfamily a.65.1: Annexin [47874] (1 family) (S)
  5. 4584Family a.65.1.1: Annexin [47875] (7 proteins)
  6. 4585Protein Annexin 24(ca32) [47892] (1 species)
  7. 4586Species Bell pepper (Capsicum annuum) [TaxId:4072] [47893] (1 PDB entry)
  8. 4587Domain d1dk5a_: 1dk5 A: [18192]

Details for d1dk5a_

PDB Entry: 1dk5 (more details), 2.8 Å

PDB Description: crystal structure of annexin 24(ca32) from capsicum annuum

SCOP Domain Sequences for d1dk5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dk5a_ a.65.1.1 (A:) Annexin 24(ca32) {Bell pepper (Capsicum annuum)}
hhhhmasltvpahvpsaaedceqlrsafkgwgtnekliisilahrtaaqrklirqtyaet
fgedllkeldrelthdfeklvlvwtldpserdahlakeatkrwtksnfvlvelactrspk
elvlareayharykksleedvayhttgdhrkllvplvssyryggeevdlrlakaeskilh
ekisdkaysddevirilatrskaqlnatlnhykdehgedilkqledgdefvallratikg
lvypehyfvevlrdainrrgteedhltrviatraevdlkiiadeyqkrdsiplgraiakd
trgdyesmllallgqe

SCOP Domain Coordinates for d1dk5a_:

Click to download the PDB-style file with coordinates for d1dk5a_.
(The format of our PDB-style files is described here.)

Timeline for d1dk5a_: