Lineage for d1dk5a1 (1dk5 A:9-320)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717085Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2717086Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2717087Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2717177Protein Plant annexin-like protein [47892] (2 species)
  7. 2717178Species Bell pepper (Capsicum annuum) [TaxId:4072] [47893] (1 PDB entry)
  8. 2717179Domain d1dk5a1: 1dk5 A:9-320 [18192]
    Other proteins in same PDB: d1dk5a2, d1dk5b2
    complexed with so4

Details for d1dk5a1

PDB Entry: 1dk5 (more details), 2.8 Å

PDB Description: crystal structure of annexin 24(ca32) from capsicum annuum
PDB Compounds: (A:) annexin 24(ca32)

SCOPe Domain Sequences for d1dk5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dk5a1 a.65.1.1 (A:9-320) Plant annexin-like protein {Bell pepper (Capsicum annuum) [TaxId: 4072]}
masltvpahvpsaaedceqlrsafkgwgtnekliisilahrtaaqrklirqtyaetfged
llkeldrelthdfeklvlvwtldpserdahlakeatkrwtksnfvlvelactrspkelvl
areayharykksleedvayhttgdhrkllvplvssyryggeevdlrlakaeskilhekis
dkaysddevirilatrskaqlnatlnhykdehgedilkqledgdefvallratikglvyp
ehyfvevlrdainrrgteedhltrviatraevdlkiiadeyqkrdsiplgraiakdtrgd
yesmllallgqe

SCOPe Domain Coordinates for d1dk5a1:

Click to download the PDB-style file with coordinates for d1dk5a1.
(The format of our PDB-style files is described here.)

Timeline for d1dk5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dk5a2