SCOPe 2.03: Domain d3n5jf_: 3n5j F:

Lineage for d3n5jf_ (3n5j F:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)

6. Protein automated matches [190489] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187688] (34 PDB entries)

8. Domain d3n5jf_: 3n5j F: [181914]
   automated match to d1fpsa_
   complexed with go1, po4

Details for d3n5jf_

PDB Entry: 3n5j, 2.35 Å

PDB Description: Human fpps complex with NOV_311

PDB Compounds: (F:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d3n5jf_:

Sequence; same for both SEQRES and ATOM records:

>d3n5jf_ a.128.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvva
frelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgld
aindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvr
ftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyld
lfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyee
ldlpavflqyeedsyshimalieqyaaplppavflglarkiyk

Timeline for d3n5jf_:

• d3n5jf_ first appeared in SCOPe 2.01
  
• d3n5jf_ appears in SCOPe 2.02
  
• d3n5jf_ appears in SCOPe 2.04
  
• d3n5jf_ appears in the current release, SCOPe 2.08