Lineage for d3n55.1 (3n55 A:,B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772197Family b.6.1.7: SO1698-like [141095] (1 protein)
    probably related to cupredoxins but lacking the metal-binding site
    automatically mapped to Pfam PF08985
  6. 2772198Protein Hypothetical protein SO1698 [141096] (1 species)
  7. 2772199Species Shewanella oneidensis [TaxId:70863] [141097] (1 PDB entry)
    Uniprot Q8EGA7 6-116,117-124
  8. 2772200Domain d3n55.1: 3n55 A:,B: [181907]
    possible postranslational autocatalytic modification: peptide bond to lysine sidechain-mainchain amide bond shift, resulting in the backbone cleavage near the C-terminus
    complexed with act, bme, zn

Details for d3n55.1

PDB Entry: 3n55 (more details), 1.57 Å

PDB Description: so1698 protein, an aspartic peptidase from shewanella oneidensis.
PDB Compounds: (A:) Peptidase, (B:) Peptidase

SCOPe Domain Sequences for d3n55.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g3n55.1 b.6.1.7 (A:,B:) Hypothetical protein SO1698 {Shewanella oneidensis [TaxId: 70863]}
glaqfikvnvtlengepvfiytdangqvcqgditvtqagtityllndqtlkglkfvgvgf
vtpfdgiidavtissdgmlvqlvdldktpgttkfqfvlsntantllvlspdXpqiinrp

SCOPe Domain Coordinates for d3n55.1:

Click to download the PDB-style file with coordinates for d3n55.1.
(The format of our PDB-style files is described here.)

Timeline for d3n55.1: