SCOPe 2.08: Domain d3n55.1: 3n55 A:,B:

Lineage for d3n55.1 (3n55 A:,B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.7: SO1698-like [141095] (1 protein)
   probably related to cupredoxins but lacking the metal-binding site
   automatically mapped to Pfam PF08985

6. Protein Hypothetical protein SO1698 [141096] (1 species)

7. Species Shewanella oneidensis [TaxId:70863] [141097] (1 PDB entry)
   Uniprot Q8EGA7 6-116,117-124

8. Domain d3n55.1: 3n55 A:,B: [181907]
   possible postranslational autocatalytic modification: peptide bond to lysine sidechain-mainchain amide bond shift, resulting in the backbone cleavage near the C-terminus
   complexed with act, bme, zn

Details for d3n55.1

PDB Entry: 3n55, 1.57 Å

PDB Description: so1698 protein, an aspartic peptidase from shewanella oneidensis.

PDB Compounds: (A:) Peptidase, (B:) Peptidase

SCOPe Domain Sequences for d3n55.1:

Sequence; same for both SEQRES and ATOM records:

>g3n55.1 b.6.1.7 (A:,B:) Hypothetical protein SO1698 {Shewanella oneidensis [TaxId: 70863]}
glaqfikvnvtlengepvfiytdangqvcqgditvtqagtityllndqtlkglkfvgvgf
vtpfdgiidavtissdgmlvqlvdldktpgttkfqfvlsntantllvlspdXpqiinrp

Timeline for d3n55.1:

• d3n55.1 first appeared in SCOPe 2.01
  
• d3n55.1 appears in SCOPe 2.07