![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.7: SO1698-like [141095] (1 protein) probably related to cupredoxins but lacking the metal-binding site automatically mapped to Pfam PF08985 |
![]() | Protein Hypothetical protein SO1698 [141096] (1 species) |
![]() | Species Shewanella oneidensis [TaxId:70863] [141097] (1 PDB entry) Uniprot Q8EGA7 6-116,117-124 |
![]() | Domain d3n55.1: 3n55 A:,B: [181907] possible postranslational autocatalytic modification: peptide bond to lysine sidechain-mainchain amide bond shift, resulting in the backbone cleavage near the C-terminus complexed with act, bme, zn |
PDB Entry: 3n55 (more details), 1.57 Å
SCOPe Domain Sequences for d3n55.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g3n55.1 b.6.1.7 (A:,B:) Hypothetical protein SO1698 {Shewanella oneidensis [TaxId: 70863]} glaqfikvnvtlengepvfiytdangqvcqgditvtqagtityllndqtlkglkfvgvgf vtpfdgiidavtissdgmlvqlvdldktpgttkfqfvlsntantllvlspdXpqiinrp
Timeline for d3n55.1: