SCOPe 2.08: Domain d3n53b1: 3n53 B:2-122

Lineage for d3n53b1 (3n53 B:2-122)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Pelobacter carbinolicus [TaxId:338963] [189418] (1 PDB entry)

8. Domain d3n53b1: 3n53 B:2-122 [181906]
   Other proteins in same PDB: d3n53a2, d3n53b2
   automated match to d1b00a_

Details for d3n53b1

PDB Entry: 3n53, 2.2 Å

PDB Description: crystal structure of a response regulator receiver modulated diguanylate cyclase from pelobacter carbinolicus

PDB Compounds: (B:) Response regulator receiver modulated diguanylate cyclase

SCOPe Domain Sequences for d3n53b1:

Sequence, based on SEQRES records:

>d3n53b1 c.23.1.0 (B:2-122) automated matches {Pelobacter carbinolicus [TaxId: 338963]}
kkiliidqqdfsrielknfldseylviesknekealeqidhhhpdlvildmdiigenspn
lclklkrskglknvplillfssehkeaivnglhsgaddyltkpfnrndllsrieihlrtq
n

Sequence, based on observed residues (ATOM records):

>d3n53b1 c.23.1.0 (B:2-122) automated matches {Pelobacter carbinolicus [TaxId: 338963]}
kkiliidqqdfsrielknfldseylviesknekealeqidhhhpdlvildmdnlclklvp
lillfsaddyltkpfnrndllsrieihlrtqn

Timeline for d3n53b1:

• d3n53b1 first appeared in SCOPe 2.01, called d3n53b_
  
• d3n53b1 appears in SCOPe 2.07