Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (86 species) not a true protein |
Species Pelobacter carbinolicus [TaxId:338963] [189418] (1 PDB entry) |
Domain d3n53b1: 3n53 B:2-122 [181906] Other proteins in same PDB: d3n53a2, d3n53b2 automated match to d1b00a_ |
PDB Entry: 3n53 (more details), 2.2 Å
SCOPe Domain Sequences for d3n53b1:
Sequence, based on SEQRES records: (download)
>d3n53b1 c.23.1.0 (B:2-122) automated matches {Pelobacter carbinolicus [TaxId: 338963]} kkiliidqqdfsrielknfldseylviesknekealeqidhhhpdlvildmdiigenspn lclklkrskglknvplillfssehkeaivnglhsgaddyltkpfnrndllsrieihlrtq n
>d3n53b1 c.23.1.0 (B:2-122) automated matches {Pelobacter carbinolicus [TaxId: 338963]} kkiliidqqdfsrielknfldseylviesknekealeqidhhhpdlvildmdnlclklvp lillfsaddyltkpfnrndllsrieihlrtqn
Timeline for d3n53b1: