Lineage for d3n53a_ (3n53 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1158037Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1158378Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1158379Protein automated matches [190131] (17 species)
    not a true protein
  7. 1158413Species Pelobacter carbinolicus [TaxId:338963] [189418] (1 PDB entry)
  8. 1158414Domain d3n53a_: 3n53 A: [181905]
    automated match to d1b00a_

Details for d3n53a_

PDB Entry: 3n53 (more details), 2.2 Å

PDB Description: crystal structure of a response regulator receiver modulated diguanylate cyclase from pelobacter carbinolicus
PDB Compounds: (A:) Response regulator receiver modulated diguanylate cyclase

SCOPe Domain Sequences for d3n53a_:

Sequence, based on SEQRES records: (download)

>d3n53a_ c.23.1.0 (A:) automated matches {Pelobacter carbinolicus [TaxId: 338963]}
lkkiliidqqdfsrielknfldseylviesknekealeqidhhhpdlvildmdiigensp
nlclklkrskglknvplillfssehkeaivnglhsgaddyltkpfnrndllsrieihlrt
qnyysdl

Sequence, based on observed residues (ATOM records): (download)

>d3n53a_ c.23.1.0 (A:) automated matches {Pelobacter carbinolicus [TaxId: 338963]}
lkkiliidqqdfsrielknfldseylviesknekealeqidhhhpdlvildmdinlclkl
krskglknvplillfssaivnglhsgaddyltkpfnrndllsrieihlrtqnyysdl

SCOPe Domain Coordinates for d3n53a_:

Click to download the PDB-style file with coordinates for d3n53a_.
(The format of our PDB-style files is described here.)

Timeline for d3n53a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3n53b_