Lineage for d3n52c_ (3n52 C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2499233Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2499234Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2499235Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 protein domains)
  6. 2499363Protein Macrophage inflammatory protein-2 [54152] (1 species)
  7. 2499364Species Mouse (Mus musculus) [TaxId:10090] [54153] (2 PDB entries)
  8. 2499367Domain d3n52c_: 3n52 C: [181903]
    automated match to d1mi2a_

Details for d3n52c_

PDB Entry: 3n52 (more details), 1.9 Å

PDB Description: crystal structure analysis of mip2
PDB Compounds: (C:) C-X-C motif chemokine 2

SCOPe Domain Sequences for d3n52c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n52c_ d.9.1.1 (C:) Macrophage inflammatory protein-2 {Mouse (Mus musculus) [TaxId: 10090]}
selrcqclktlprvdfkniqslsvtppgphcaqteviatlkggqkvcldpeaplvqkiiq
kilnkgk

SCOPe Domain Coordinates for d3n52c_:

Click to download the PDB-style file with coordinates for d3n52c_.
(The format of our PDB-style files is described here.)

Timeline for d3n52c_: