Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family) contains one classic and one pseudo HhH motifs |
Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins) |
Protein automated matches [191020] (3 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [189388] (2 PDB entries) |
Domain d3n4mc_: 3n4m C: [181900] Other proteins in same PDB: d3n4ma1, d3n4ma2 automated match to d1cooa_ protein/DNA complex; protein/RNA complex; complexed with cmp, peg |
PDB Entry: 3n4m (more details), 2.99 Å
SCOPe Domain Sequences for d3n4mc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n4mc_ a.60.3.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]} dpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvlas rglslgmrlenwp
Timeline for d3n4mc_: