Lineage for d3n4mc_ (3n4m C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001386Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 2001387Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins)
  6. 2001399Protein automated matches [191020] (3 species)
    not a true protein
  7. 2001405Species Escherichia coli K-12 [TaxId:83333] [189388] (2 PDB entries)
  8. 2001415Domain d3n4mc_: 3n4m C: [181900]
    Other proteins in same PDB: d3n4ma1, d3n4ma2
    automated match to d1cooa_
    protein/DNA complex; protein/RNA complex; complexed with cmp, peg

Details for d3n4mc_

PDB Entry: 3n4m (more details), 2.99 Å

PDB Description: e. coli rna polymerase alpha subunit c-terminal domain in complex with cap and dna
PDB Compounds: (C:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d3n4mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n4mc_ a.60.3.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvlas
rglslgmrlenwp

SCOPe Domain Coordinates for d3n4mc_:

Click to download the PDB-style file with coordinates for d3n4mc_.
(The format of our PDB-style files is described here.)

Timeline for d3n4mc_: