SCOPe 2.05: Domain d3n4mb_: 3n4m B:

Lineage for d3n4mb_ (3n4m B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins)

6. Protein automated matches [191020] (2 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189388] (2 PDB entries)

8. Domain d3n4mb_: 3n4m B: [181899]
   Other proteins in same PDB: d3n4ma1, d3n4ma2
   automated match to d1cooa_
   protein/DNA complex; protein/RNA complex; complexed with cmp, peg

Details for d3n4mb_

PDB Entry: 3n4m, 2.99 Å

PDB Description: E. coli RNA polymerase alpha subunit C-terminal domain in complex with CAP and DNA

PDB Compounds: (B:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d3n4mb_:

Sequence; same for both SEQRES and ATOM records:

>d3n4mb_ a.60.3.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
fdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvla
srglslgmrlenwp

Timeline for d3n4mb_:

• d3n4mb_ first appeared in SCOPe 2.01
  
• d3n4mb_ appears in SCOPe 2.04
  
• d3n4mb_ appears in SCOPe 2.06
  
• d3n4mb_ appears in the current release, SCOPe 2.07