SCOPe 2.08: Domain d3n4kb1: 3n4k B:1-159

Lineage for d3n4kb1 (3n4k B:1-159)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.1: SpoU-like RNA 2'-O ribose methyltransferase [75218] (5 proteins)
   contains extra strand (3) in the parallel beta-sheet, order 321546

6. Protein automated matches [191165] (4 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [189377] (2 PDB entries)

8. Domain d3n4kb1: 3n4k B:1-159 [181895]
   Other proteins in same PDB: d3n4ka2, d3n4kb2
   automated match to d1j85a_
   protein/RNA complex; complexed with sah

Details for d3n4kb1

PDB Entry: 3n4k, 1.76 Å

PDB Description: putative rna methyltransferase from yersinia pestis in complex with s- adenosyl-l-homocysteine.

PDB Compounds: (B:) RNA methyltransferase

SCOPe Domain Sequences for d3n4kb1:

Sequence; same for both SEQRES and ATOM records:

>d3n4kb1 c.116.1.1 (B:1-159) automated matches {Yersinia pestis [TaxId: 214092]}
mlnivlfepeippntgniirlcantgcqlhlikplgftwddkrlrragldyhefadikhh
hdyqafldsekldstqparlfalttkgtpahsavsyqandyllfgpetrglpayildalp
aqqkiripmqadsrsmnlsnavsvvvyeawrqlgypgal

Timeline for d3n4kb1:

• d3n4kb1 first appeared in SCOPe 2.01, called d3n4kb_
  
• d3n4kb1 appears in SCOPe 2.07