SCOPe 2.01: Domain d3n4ja_: 3n4j A:

Lineage for d3n4ja_ (3n4j A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.1: SpoU-like RNA 2'-O ribose methyltransferase [75218] (5 proteins)
   contains extra strand (3) in the parallel beta-sheet, order 321546

6. Protein automated matches [191165] (1 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [189377] (2 PDB entries)

8. Domain d3n4ja_: 3n4j A: [181893]
   automated match to d1j85a_
   complexed with so4

Details for d3n4ja_

PDB Entry: 3n4j, 1.47 Å

PDB Description: putative rna methyltransferase from yersinia pestis

PDB Compounds: (A:) RNA methyltransferase

SCOPe Domain Sequences for d3n4ja_:

Sequence; same for both SEQRES and ATOM records:

>d3n4ja_ c.116.1.1 (A:) automated matches {Yersinia pestis [TaxId: 214092]}
amlnivlfepeippntgniirlcantgcqlhlikplgftwddkrlrragldyhefadikh
hhdyqafldsekldstqparlfalttkgtpahsavsyqandyllfgpetrglpayildal
paqqkiripmqadsrsmnlsnavsvvvyeawrqlgypgall

Timeline for d3n4ja_:

• d3n4ja_ is new in SCOPe 2.01-stable
  
• d3n4ja_ appears in SCOPe 2.02
  
• d3n4ja_ appears in the current release, SCOPe 2.08, called d3n4ja1