Lineage for d1dm5d_ (1dm5 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717085Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2717086Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2717087Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2717162Protein Annexin XII [47889] (2 species)
  7. 2717170Species Hydra vulgaris [TaxId:6087] [47891] (1 PDB entry)
  8. 2717174Domain d1dm5d_: 1dm5 D: [18189]
    complexed with ca; mutant

Details for d1dm5d_

PDB Entry: 1dm5 (more details), 1.93 Å

PDB Description: annexin xii e105k homohexamer crystal structure
PDB Compounds: (D:) annexin xii e105k mutant homohexamer

SCOPe Domain Sequences for d1dm5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dm5d_ a.65.1.1 (D:) Annexin XII {Hydra vulgaris [TaxId: 6087]}
vvqgtvkphasfnsredaetlrkamkgigtdeksithilatrsnaqrqqiktdyttlfgk
hledelkselsgnyeaaalallrkpdeflaeqlhaamkglgtdknalidilctqsnaqih
aikaafkllykedlekeiisetsgnfqrllvsmlqggrkedepvnaahaaedaaaiyqag
egqigtdesrfnavlatrsypqlhqifheyskisnktilqaienefsgdikngllaivks
venrfayfaerlhhamkglgtsdktlirilvsrseidlaniketfqamygkslyefiadd
csgdykdlllqitgh

SCOPe Domain Coordinates for d1dm5d_:

Click to download the PDB-style file with coordinates for d1dm5d_.
(The format of our PDB-style files is described here.)

Timeline for d1dm5d_: