SCOPe 2.05: Domain d3n3zb_: 3n3z B:

Lineage for d3n3zb_ (3n3z B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109943] (19 PDB entries)
   Uniprot O76083 241-566

8. Domain d3n3zb_: 3n3z B: [181883]
   automated match to d2hd1a1
   complexed with cl, ibm, mg, zn; mutant

Details for d3n3zb_

PDB Entry: 3n3z, 2.75 Å

PDB Description: Crystal structure of PDE9A (E406A) mutant in complex with IBMX

PDB Compounds: (B:) High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOPe Domain Sequences for d3n3zb_:

Sequence; same for both SEQRES and ATOM records:

>d3n3zb_ a.211.1.2 (B:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
ptypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlf
cvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgyn
ntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitli
latdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnavrpmevaepwvdcl
leeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeiml
qplwesrdryeelkriddamkelqkk

Timeline for d3n3zb_:

• d3n3zb_ first appeared in SCOPe 2.01
  
• d3n3zb_ appears in SCOPe 2.04
  
• d3n3zb_ appears in SCOPe 2.06
  
• d3n3zb_ appears in the current release, SCOPe 2.08