Lineage for d1dm5c_ (1dm5 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000010Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2000011Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2000012Family a.65.1.1: Annexin [47875] (10 protein domains)
  6. 2000087Protein Annexin XII [47889] (2 species)
  7. 2000095Species Hydra vulgaris [TaxId:6087] [47891] (1 PDB entry)
  8. 2000098Domain d1dm5c_: 1dm5 C: [18188]
    complexed with ca; mutant

Details for d1dm5c_

PDB Entry: 1dm5 (more details), 1.93 Å

PDB Description: annexin xii e105k homohexamer crystal structure
PDB Compounds: (C:) annexin xii e105k mutant homohexamer

SCOPe Domain Sequences for d1dm5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dm5c_ a.65.1.1 (C:) Annexin XII {Hydra vulgaris [TaxId: 6087]}
vvqgtvkphasfnsredaetlrkamkgigtdeksithilatrsnaqrqqiktdyttlfgk
hledelkselsgnyeaaalallrkpdeflaeqlhaamkglgtdknalidilctqsnaqih
aikaafkllykedlekeiisetsgnfqrllvsmlqggrkedepvnaahaaedaaaiyqag
egqigtdesrfnavlatrsypqlhqifheyskisnktilqaienefsgdikngllaivks
venrfayfaerlhhamkglgtsdktlirilvsrseidlaniketfqamygkslyefiadd
csgdykdlllqitgh

SCOPe Domain Coordinates for d1dm5c_:

Click to download the PDB-style file with coordinates for d1dm5c_.
(The format of our PDB-style files is described here.)

Timeline for d1dm5c_: