Lineage for d3n3mb1 (3n3m B:1-321)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090271Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2090369Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 2090509Protein automated matches [190130] (11 species)
    not a true protein
  7. 2090767Species Plasmodium falciparum [TaxId:36329] [187244] (5 PDB entries)
  8. 2090769Domain d3n3mb1: 3n3m B:1-321 [181878]
    Other proteins in same PDB: d3n3ma2, d3n3mb2
    automated match to d2f84a1
    complexed with edo, gol, nup, pge, po4

Details for d3n3mb1

PDB Entry: 3n3m (more details), 1.47 Å

PDB Description: Crystal structure of Plasmodium falciparum orotidine 5'-monophosphate decarboxylase complexed with 6-amino-UMP
PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3n3mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n3mb1 c.1.2.3 (B:1-321) automated matches {Plasmodium falciparum [TaxId: 36329]}
mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
ypqkaaqmyydqinailkqnm

SCOPe Domain Coordinates for d3n3mb1:

Click to download the PDB-style file with coordinates for d3n3mb1.
(The format of our PDB-style files is described here.)

Timeline for d3n3mb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n3mb2