Lineage for d3n3lf_ (3n3l F:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 924604Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 924605Superfamily a.128.1: Terpenoid synthases [48576] (5 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 924606Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)
  6. 924645Protein automated matches [190489] (4 species)
    not a true protein
  7. 924646Species Human (Homo sapiens) [TaxId:9606] [187688] (20 PDB entries)
  8. 924666Domain d3n3lf_: 3n3l F: [181876]
    automated match to d1fpsa_
    complexed with ms0, po4

Details for d3n3lf_

PDB Entry: 3n3l (more details), 2.74 Å

PDB Description: Human FPPS complex with FBS_03
PDB Compounds: (F:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d3n3lf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n3lf_ a.128.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvva
frelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgld
aindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvr
ftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyld
lfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyee
ldlpavflqyeedsyshimalieqyaaplppavflglarkiyk

SCOPe Domain Coordinates for d3n3lf_:

Click to download the PDB-style file with coordinates for d3n3lf_.
(The format of our PDB-style files is described here.)

Timeline for d3n3lf_: