Lineage for d3n3ha_ (3n3h A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2779004Species Coral tree (Erythrina corallodendron) [TaxId:3843] [189686] (3 PDB entries)
  8. 2779005Domain d3n3ha_: 3n3h A: [181873]
    automated match to d1sfya_
    complexed with ca, cit, mn; mutant

Details for d3n3ha_

PDB Entry: 3n3h (more details), 2 Å

PDB Description: Erythrina corallodendron lectin mutant (Y106G) in complex with citrate
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d3n3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n3ha_ b.29.1.1 (A:) automated matches {Coral tree (Erythrina corallodendron) [TaxId: 3843]}
vetisfsfsefepgndnltlqgaslitqsgvlqltkinqngmpawdstgrtlyakpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgggylgifnnskqdns
yqtlgvefdtfsnqwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilh
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpet
nd

SCOPe Domain Coordinates for d3n3ha_:

Click to download the PDB-style file with coordinates for d3n3ha_.
(The format of our PDB-style files is described here.)

Timeline for d3n3ha_: