Lineage for d3n3ga_ (3n3g A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926699Protein (Pro)cathepsin S [82566] (1 species)
  7. 2926700Species Human (Homo sapiens) [TaxId:9606] [82567] (28 PDB entries)
  8. 2926707Domain d3n3ga_: 3n3g A: [181871]
    automated match to d1ms6a_
    complexed with 935, 93n, dms, gol, peg, so4

Details for d3n3ga_

PDB Entry: 3n3g (more details), 1.6 Å

PDB Description: 4-(3-Trifluoromethylphenyl)-pyrimidine-2-carbonitrile as cathepsin S inhibitors: N3, not N1 is critically important
PDB Compounds: (A:) cathepsin S

SCOPe Domain Sequences for d3n3ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n3ga_ d.3.1.1 (A:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei

SCOPe Domain Coordinates for d3n3ga_:

Click to download the PDB-style file with coordinates for d3n3ga_.
(The format of our PDB-style files is described here.)

Timeline for d3n3ga_: