![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein automated matches [190035] (28 species) not a true protein |
![]() | Species Coral tree (Erythrina corallodendron) [TaxId:3843] [189686] (3 PDB entries) |
![]() | Domain d3n35a_: 3n35 A: [181869] automated match to d1sfya_ complexed with a2g, ca, mn; mutant |
PDB Entry: 3n35 (more details), 2 Å
SCOPe Domain Sequences for d3n35a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n35a_ b.29.1.1 (A:) automated matches {Coral tree (Erythrina corallodendron) [TaxId: 3843]} vetisfsfsefepgndnltlqgaslitqsgvlqltkinqngmpawdstgrtlyakpvhiw dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgggylgifnnskqdns yqtlgvefdtfsnqwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilh avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpet nd
Timeline for d3n35a_: