Lineage for d3n34a_ (3n34 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1143706Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1143783Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 1143927Protein automated matches [190130] (9 species)
    not a true protein
  7. 1144121Species Plasmodium falciparum [TaxId:36329] [187244] (5 PDB entries)
  8. 1144124Domain d3n34a_: 3n34 A: [181867]
    automated match to d2f84a1
    complexed with edo, fnu, peg, pge, po4

Details for d3n34a_

PDB Entry: 3n34 (more details), 1.55 Å

PDB Description: Crystal structure of Plasmodium falciparum orotidine 5'-monophosphate decarboxylase complexed with 5-fluoro-6-amino-UMP, produced from 5-fluoro-6-azido-UMP
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3n34a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n34a_ c.1.2.3 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
glvprgsmgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyi
nnvsikkdillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygs
vgidvlknvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnml
kdicydeeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqn
nefigfvvgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinig
raitknpypqkaaqmyydqinailkqn

SCOPe Domain Coordinates for d3n34a_:

Click to download the PDB-style file with coordinates for d3n34a_.
(The format of our PDB-style files is described here.)

Timeline for d3n34a_: