Lineage for d3n2ya_ (3n2y A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2442472Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2442655Protein Tyrosyl-tRNA synthetase (TyrRS) [52376] (6 species)
  7. 2442676Species Methanococcus jannaschii [TaxId:2190] [89611] (9 PDB entries)
  8. 2442685Domain d3n2ya_: 3n2y A: [181859]
    automated match to d1j1ua_
    protein/RNA complex; complexed with tef

Details for d3n2ya_

PDB Entry: 3n2y (more details), 2.49 Å

PDB Description: crystal structure of tyrosyl-trna synthetase complexed with p-(2- tetrazolyl)-phenylalanine
PDB Compounds: (A:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d3n2ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n2ya_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Methanococcus jannaschii [TaxId: 2190]}
defemikrntseiiseeelrevlkkdeksaligfepsgkihlghylqikkmidlqnagfd
iiiiladlhaylnqkgeldeirkigdynkkvfeamglkakyvygsefmldkdytlnvyrl
alkttlkrarrsmeliaredenpkvaeviypimqvngihyvggdvavggmeqrkihmlar
ellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpi
meiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikilep
irkrl

SCOPe Domain Coordinates for d3n2ya_:

Click to download the PDB-style file with coordinates for d3n2ya_.
(The format of our PDB-style files is described here.)

Timeline for d3n2ya_: