Lineage for d3n2ta_ (3n2t A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2081379Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2081380Protein automated matches [190793] (26 species)
    not a true protein
  7. 2081452Species Gluconobacter oxydans [TaxId:442] [189401] (1 PDB entry)
  8. 2081453Domain d3n2ta_: 3n2t A: [181852]
    automated match to d1pz1a_

Details for d3n2ta_

PDB Entry: 3n2t (more details), 2 Å

PDB Description: Structure of the glycerol dehydrogenase AKR11B4 from Gluconobacter oxydans
PDB Compounds: (A:) Putative oxidoreductase

SCOPe Domain Sequences for d3n2ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n2ta_ c.1.7.0 (A:) automated matches {Gluconobacter oxydans [TaxId: 442]}
masdtiripgidtplsrvalgtwaiggwmwggpdddngvrtihaaldeginlidtapvyg
fghseeivgralaekpnkahvatklglhwvgedeknmkvfrdsrparirkevedslrrlr
vetidleqihwpddktpidesarelqklhqdgkiralgvsnfspeqmdifrevaplatiq
pplnlfertiekdilpyaekhnavvlaygalcrglltgkmnrdttfpkddlrsndpkfqk
pnfekylaamdefeklaekrgksvmafavrwvldqgpvialwgarkpgqvsgvkdvfgws
ltdeekkavddilarhvpnpidptfma

SCOPe Domain Coordinates for d3n2ta_:

Click to download the PDB-style file with coordinates for d3n2ta_.
(The format of our PDB-style files is described here.)

Timeline for d3n2ta_: