Lineage for d3n2sd_ (3n2s D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963435Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2963436Protein automated matches [190672] (32 species)
    not a true protein
  7. 2963440Species Bacillus subtilis [TaxId:1423] [188288] (2 PDB entries)
  8. 2963444Domain d3n2sd_: 3n2s D: [181851]
    automated match to d1bkja_
    complexed with cl, fmn

Details for d3n2sd_

PDB Entry: 3n2s (more details), 1.95 Å

PDB Description: Structure of NfrA1 nitroreductase from B. subtilis
PDB Compounds: (D:) NADPH-dependent nitro/flavin reductase

SCOPe Domain Sequences for d3n2sd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n2sd_ d.90.1.0 (D:) automated matches {Bacillus subtilis [TaxId: 1423]}
ntietilnhrsirsftdqlltaeeidtlvksaqaastssyvqaysiigvsdpekkrelsv
lagnqpyveknghffvfcadlyrhqqlaeekgehisellentemfmvslidaalaaqnms
iaaesmglgicyiggirneldkvtevlqtpdhvlplfglavghpanlsgkkprlpkqavy
hentynvntddfrhtmntydktisdyyrertngkreetwsdqilnfmkqkprtylndyvk
ekgfnkn

SCOPe Domain Coordinates for d3n2sd_:

Click to download the PDB-style file with coordinates for d3n2sd_.
(The format of our PDB-style files is described here.)

Timeline for d3n2sd_: