SCOPe 2.07: Domain d3n2sc_: 3n2s C:

Lineage for d3n2sc_ (3n2s C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
   core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243

4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families)

5. Family d.90.1.0: automated matches [191446] (1 protein)
   not a true family

6. Protein automated matches [190672] (29 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [188288] (2 PDB entries)

8. Domain d3n2sc_: 3n2s C: [181850]
   automated match to d1bkja_
   complexed with cl, fmn

Details for d3n2sc_

PDB Entry: 3n2s, 1.95 Å

PDB Description: Structure of NfrA1 nitroreductase from B. subtilis

PDB Compounds: (C:) NADPH-dependent nitro/flavin reductase

SCOPe Domain Sequences for d3n2sc_:

Sequence; same for both SEQRES and ATOM records:

>d3n2sc_ d.90.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]}
nntietilnhrsirsftdqlltaeeidtlvksaqaastssyvqaysiigvsdpekkrels
vlagnqpyveknghffvfcadlyrhqqlaeekgehisellentemfmvslidaalaaqnm
siaaesmglgicyiggirneldkvtevlqtpdhvlplfglavghpanlsgkkprlpkqav
yhentynvntddfrhtmntydktisdyyrertngkreetwsdqilnfmkqkprtylndyv
kekgfnkn

Timeline for d3n2sc_:

• d3n2sc_ first appeared in SCOPe 2.01
  
• d3n2sc_ appears in SCOPe 2.06
  
• d3n2sc_ appears in the current release, SCOPe 2.08