Lineage for d1aeif_ (1aei F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717085Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2717086Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2717087Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2717162Protein Annexin XII [47889] (2 species)
  7. 2717163Species Hydra (Hydra attenuata) [TaxId:6087] [47890] (1 PDB entry)
  8. 2717169Domain d1aeif_: 1aei F: [18185]
    complexed with ca

Details for d1aeif_

PDB Entry: 1aei (more details), 2.8 Å

PDB Description: crystal structure of the annexin xii hexamer
PDB Compounds: (F:) annexin xii

SCOPe Domain Sequences for d1aeif_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aeif_ a.65.1.1 (F:) Annexin XII {Hydra (Hydra attenuata) [TaxId: 6087]}
vvqgtvkphasfnsredaetlrkamkgigtdeksithilatrsnaqrqqiktdyttlfgk
hledelkselsgnyeaaalallrkpdeflaeqlhaamkglgtdenalidilctqsnaqih
aikaafkllykedlekeiisetsgnfqrllvsmlqggrkedepvnaahaaedaaaiyqag
egqigtdesrfnavlatrsypqlhqifheyskisnktilqaienefsgdikngllaivks
venrfayfaerlhhamkglgtsdktlirilvsrseidlaniketfqamygkslyefiadd
csgdykdlllqitgh

SCOPe Domain Coordinates for d1aeif_:

Click to download the PDB-style file with coordinates for d1aeif_.
(The format of our PDB-style files is described here.)

Timeline for d1aeif_: