Lineage for d3n2sb_ (3n2s B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569893Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2569894Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2570050Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2570051Protein automated matches [190672] (29 species)
    not a true protein
  7. 2570055Species Bacillus subtilis [TaxId:1423] [188288] (2 PDB entries)
  8. 2570057Domain d3n2sb_: 3n2s B: [181849]
    automated match to d1bkja_
    complexed with cl, fmn

Details for d3n2sb_

PDB Entry: 3n2s (more details), 1.95 Å

PDB Description: Structure of NfrA1 nitroreductase from B. subtilis
PDB Compounds: (B:) NADPH-dependent nitro/flavin reductase

SCOPe Domain Sequences for d3n2sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n2sb_ d.90.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
nntietilnhrsirsftdqlltaeeidtlvksaqaastssyvqaysiigvsdpekkrels
vlagnqpyveknghffvfcadlyrhqqlaeekgehisellentemfmvslidaalaaqnm
siaaesmglgicyiggirneldkvtevlqtpdhvlplfglavghpanlsgkkprlpkqav
yhentynvntddfrhtmntydktisdyyrertngkreetwsdqilnfmkqkprtylndyv
kekgfnkn

SCOPe Domain Coordinates for d3n2sb_:

Click to download the PDB-style file with coordinates for d3n2sb_.
(The format of our PDB-style files is described here.)

Timeline for d3n2sb_: