SCOPe 2.05: Domain d3n2nc_: 3n2n C:

Lineage for d3n2nc_ (3n2n C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)

6. Protein automated matches [190060] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186779] (11 PDB entries)

8. Domain d3n2nc_: 3n2n C: [181841]
   automated match to d1shux_
   complexed with act, mg

Details for d3n2nc_

PDB Entry: 3n2n, 1.8 Å

PDB Description: The Crystal Structure of Tumor Endothelial Marker 8 (TEM8) extracellular domain

PDB Compounds: (C:) Anthrax toxin receptor 1

SCOPe Domain Sequences for d3n2nc_:

Sequence; same for both SEQRES and ATOM records:

>d3n2nc_ c.62.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smacyggfdlyfildksgsvlhhwneiyyfveqlahkfispqlrmsfivfstrgttlmkl
tedreqirqgleelqkvlpggdtymhegferaseqiyyenrqgyrtasviialtdgelhe
dlffysereanrsrdlgaivyavgvkdfnetqlariadskdhvfpvndgfqalqgiihsi
lkksc

Timeline for d3n2nc_:

• d3n2nc_ first appeared in SCOPe 2.01
  
• d3n2nc_ appears in SCOPe 2.04
  
• d3n2nc_ is called d3n2nc1 in SCOPe 2.06
  
• d3n2nc_ appears in the current release, SCOPe 2.08, called d3n2nc1