Lineage for d3n2nc_ (3n2n C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999157Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 999158Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 999159Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 999290Protein automated matches [190060] (1 species)
    not a true protein
  7. 999291Species Human (Homo sapiens) [TaxId:9606] [186779] (6 PDB entries)
  8. 999294Domain d3n2nc_: 3n2n C: [181841]
    automated match to d1shux_
    complexed with act, mg

Details for d3n2nc_

PDB Entry: 3n2n (more details), 1.8 Å

PDB Description: The Crystal Structure of Tumor Endothelial Marker 8 (TEM8) extracellular domain
PDB Compounds: (C:) Anthrax toxin receptor 1

SCOPe Domain Sequences for d3n2nc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n2nc_ c.62.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smacyggfdlyfildksgsvlhhwneiyyfveqlahkfispqlrmsfivfstrgttlmkl
tedreqirqgleelqkvlpggdtymhegferaseqiyyenrqgyrtasviialtdgelhe
dlffysereanrsrdlgaivyavgvkdfnetqlariadskdhvfpvndgfqalqgiihsi
lkksc

SCOPe Domain Coordinates for d3n2nc_:

Click to download the PDB-style file with coordinates for d3n2nc_.
(The format of our PDB-style files is described here.)

Timeline for d3n2nc_: