Lineage for d3n2nb1 (3n2n B:38-220)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892196Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2892349Protein automated matches [190060] (2 species)
    not a true protein
  7. 2892352Species Human (Homo sapiens) [TaxId:9606] [186779] (22 PDB entries)
  8. 2892354Domain d3n2nb1: 3n2n B:38-220 [181840]
    Other proteins in same PDB: d3n2na2, d3n2nb2, d3n2nc2, d3n2nd2, d3n2ne2, d3n2nf2
    automated match to d1shux_
    complexed with act, mg

Details for d3n2nb1

PDB Entry: 3n2n (more details), 1.8 Å

PDB Description: The Crystal Structure of Tumor Endothelial Marker 8 (TEM8) extracellular domain
PDB Compounds: (B:) Anthrax toxin receptor 1

SCOPe Domain Sequences for d3n2nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n2nb1 c.62.1.1 (B:38-220) automated matches {Human (Homo sapiens) [TaxId: 9606]}
acyggfdlyfildksgsvlhhwneiyyfveqlahkfispqlrmsfivfstrgttlmklte
dreqirqgleelqkvlpggdtymhegferaseqiyyenrqgyrtasviialtdgelhedl
ffysereanrsrdlgaivyavgvkdfnetqlariadskdhvfpvndgfqalqgiihsilk
ksc

SCOPe Domain Coordinates for d3n2nb1:

Click to download the PDB-style file with coordinates for d3n2nb1.
(The format of our PDB-style files is described here.)

Timeline for d3n2nb1: