![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.62.1: vWA-like [53300] (6 families) ![]() |
![]() | Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins) |
![]() | Protein automated matches [190060] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186779] (6 PDB entries) |
![]() | Domain d3n2na_: 3n2n A: [181839] automated match to d1shux_ complexed with act, mg |
PDB Entry: 3n2n (more details), 1.8 Å
SCOPe Domain Sequences for d3n2na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n2na_ c.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} smacyggfdlyfildksgsvlhhwneiyyfveqlahkfispqlrmsfivfstrgttlmkl tedreqirqgleelqkvlpggdtymhegferaseqiyyenrqgyrtasviialtdgelhe dlffysereanrsrdlgaivyavgvkdfnetqlariadskdhvfpvndgfqalqgiihsi lkksc
Timeline for d3n2na_: