SCOPe 2.05: Domain d3n2ma_: 3n2m A:

Lineage for d3n2ma_ (3n2m A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.3: Decarboxylase [51375] (4 proteins)

6. Protein automated matches [190130] (11 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [187244] (5 PDB entries)

8. Domain d3n2ma_: 3n2m A: [181837]
   automated match to d2f84a1
   complexed with edo, fnu, peg, so4, trs

Details for d3n2ma_

PDB Entry: 3n2m, 1.8 Å

PDB Description: Crystal structure of Plasmodium falciparum orotidine 5'-monophosphate decarboxylase complexed with 5-fluoro-6-amino-UMP

PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3n2ma_:

Sequence; same for both SEQRES and ATOM records:

>d3n2ma_ c.1.2.3 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
glvprgsmgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyi
nnvsikkdillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygs
vgidvlknvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnml
kdicydeeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqn
nefigfvvgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinig
raitknpypqkaaqmyydqinailkqnm

Timeline for d3n2ma_:

• d3n2ma_ first appeared in SCOPe 2.01
  
• d3n2ma_ appears in SCOPe 2.04
  
• d3n2ma_ is called d3n2ma1 in SCOPe 2.06
  
• d3n2ma_ appears in the current release, SCOPe 2.08, called d3n2ma1