SCOPe 2.01: Domain d3n2da_: 3n2d A:

Lineage for d3n2da_ (3n2d A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (8 species)
   not a true protein

7. Species Momordica balsamina [TaxId:3672] [189375] (22 PDB entries)

8. Domain d3n2da_: 3n2d A: [181836]
   automated match to d1ahaa_

Details for d3n2da_

PDB Entry: 3n2d, 2.22 Å

PDB Description: crystal structure of the complex of type i ribosome inactivating protein with hexapeptide ser-asp-asp-asp-met-gly at 2.2 a resolution

PDB Compounds: (A:) Ribosome inactivating protein

SCOPe Domain Sequences for d3n2da_:

Sequence; same for both SEQRES and ATOM records:

>d3n2da_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

Timeline for d3n2da_:

• d3n2da_ is new in SCOPe 2.01-stable
  
• d3n2da_ appears in SCOPe 2.02
  
• d3n2da_ appears in the current release, SCOPe 2.08