Lineage for d3n26a_ (3n26 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163623Species Chlamydophila pneumoniae [TaxId:83558] [189367] (3 PDB entries)
  8. 2163626Domain d3n26a_: 3n26 A: [181835]
    automated match to d1hpbp_
    complexed with arg

Details for d3n26a_

PDB Entry: 3n26 (more details), 2.1 Å

PDB Description: Cpn0482 : the arginine binding protein from the periplasm of chlamydia Pneumoniae
PDB Compounds: (A:) Amino acid ABC transporter, periplasmic amino acid-binding protein

SCOPe Domain Sequences for d3n26a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n26a_ c.94.1.0 (A:) automated matches {Chlamydophila pneumoniae [TaxId: 83558]}
drnriwivgtnatyppfeyvdaqgevvgfdidlakaiseklgkqlevrefafdalilnlk
khridailagmsitpsrqkeiallpyygdevqelmvvskrsletpvlpltqhssvavqtg
tfqehyllsqpgicvrsfdstlevimevrygkspvavlepsvgrvvlkdfpnlvatrlel
ppecwvlgcglgvakdrpeeiqtiqqaitdlksegviqsltkkwqlsevay

SCOPe Domain Coordinates for d3n26a_:

Click to download the PDB-style file with coordinates for d3n26a_.
(The format of our PDB-style files is described here.)

Timeline for d3n26a_: