Lineage for d3n1zc_ (3n1z C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2542243Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 2542244Family d.15.12.1: TmoB-like [110815] (1 protein)
    Pfam PF06234
  6. 2542245Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (2 species)
  7. 2542246Species Pseudomonas sp. [TaxId:320855] [189499] (11 PDB entries)
  8. 2542254Domain d3n1zc_: 3n1z C: [181829]
    Other proteins in same PDB: d3n1za_, d3n1zb_
    automated match to d1t0rc_
    complexed with fe, gol, p6g; mutant

Details for d3n1zc_

PDB Entry: 3n1z (more details), 2.9 Å

PDB Description: X-ray Crystal Structure of Toluene/o-Xylene Monooxygenase Hydroxylase T201S Mutant
PDB Compounds: (C:) Toluene o-xylene monooxygenase component

SCOPe Domain Sequences for d3n1zc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n1zc_ d.15.12.1 (C:) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas sp. [TaxId: 320855]}
tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf
prgmivsdaglrptetldiifmd

SCOPe Domain Coordinates for d3n1zc_:

Click to download the PDB-style file with coordinates for d3n1zc_.
(The format of our PDB-style files is described here.)

Timeline for d3n1zc_: