Lineage for d3n1yb_ (3n1y B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703588Protein Toluene, o-xylene monooxygenase oxygenase subunit TouE [109790] (2 species)
  7. 2703589Species Pseudomonas sp. [TaxId:320855] [189498] (11 PDB entries)
  8. 2703591Domain d3n1yb_: 3n1y B: [181825]
    Other proteins in same PDB: d3n1ya_, d3n1yc_
    automated match to d1t0rb_
    complexed with fe, gol, p6g; mutant

Details for d3n1yb_

PDB Entry: 3n1y (more details), 2.1 Å

PDB Description: X-ray Crystal Structure of Toluene/o-Xylene Monooxygenase Hydroxylase T201G Mutant
PDB Compounds: (B:) Toluene o-xylene monooxygenase component

SCOPe Domain Sequences for d3n1yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n1yb_ a.25.1.2 (B:) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas sp. [TaxId: 320855]}
alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
pdgenaiveaksasryvrqmmg

SCOPe Domain Coordinates for d3n1yb_:

Click to download the PDB-style file with coordinates for d3n1yb_.
(The format of our PDB-style files is described here.)

Timeline for d3n1yb_: