![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.12: TmoB-like [110814] (2 families) ![]() possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies |
![]() | Family d.15.12.1: TmoB-like [110815] (1 protein) Pfam PF06234 |
![]() | Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (2 species) |
![]() | Species Pseudomonas sp. [TaxId:320855] [189499] (11 PDB entries) |
![]() | Domain d3n1xc_: 3n1x C: [181823] Other proteins in same PDB: d3n1xa_, d3n1xb_ automated match to d1t0rc_ complexed with edo, fe, oh, so4; mutant |
PDB Entry: 3n1x (more details), 2.4 Å
SCOPe Domain Sequences for d3n1xc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n1xc_ d.15.12.1 (C:) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas sp. [TaxId: 320855]} atfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtl fprgmivsdaglrptetldiifmdn
Timeline for d3n1xc_: