Lineage for d3n1wf_ (3n1w F:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 924604Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 924605Superfamily a.128.1: Terpenoid synthases [48576] (5 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 924606Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)
  6. 924645Protein automated matches [190489] (4 species)
    not a true protein
  7. 924646Species Human (Homo sapiens) [TaxId:9606] [187688] (20 PDB entries)
  8. 924662Domain d3n1wf_: 3n1w F: [181820]
    automated match to d1fpsa_
    complexed with 3n2, po4

Details for d3n1wf_

PDB Entry: 3n1w (more details), 2.56 Å

PDB Description: human fpps complex with fbs_02
PDB Compounds: (F:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d3n1wf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n1wf_ a.128.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvva
frelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgld
aindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvr
ftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyld
lfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyee
ldlpavflqyeedsyshimalieqyaaplppavflglarkiyk

SCOPe Domain Coordinates for d3n1wf_:

Click to download the PDB-style file with coordinates for d3n1wf_.
(The format of our PDB-style files is described here.)

Timeline for d3n1wf_: