Lineage for d3n1ua_ (3n1u A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1393810Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1393811Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1394417Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1394418Protein automated matches [190447] (43 species)
    not a true protein
  7. 1394639Species Legionella pneumophila [TaxId:272624] [189400] (1 PDB entry)
  8. 1394640Domain d3n1ua_: 3n1u A: [181818]
    automated match to d1j8da_
    complexed with ca

Details for d3n1ua_

PDB Entry: 3n1u (more details), 1.8 Å

PDB Description: structure of putative had superfamily (subfamily iii a) hydrolase from legionella pneumophila
PDB Compounds: (A:) Hydrolase, HAD superfamily, subfamily III A

SCOPe Domain Sequences for d3n1ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n1ua_ c.108.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]}
slnteiemnellekakkikclicdvdgvlsdgllhidnhgnelksfhvqdgmglkllmaa
giqvaiittaqnavvdhrmeqlgithyykgqvdkrsayqhlkktlglnddefayigddlp
dlpliqqvglgvavsnavpqvlefadwrtertggrgavrelcdlilnaqnkaelaitgyl
kq

SCOPe Domain Coordinates for d3n1ua_:

Click to download the PDB-style file with coordinates for d3n1ua_.
(The format of our PDB-style files is described here.)

Timeline for d3n1ua_: