Lineage for d3n1ua1 (3n1u A:4-183)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490779Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2490780Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2491513Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2491514Protein automated matches [190447] (52 species)
    not a true protein
  7. 2491775Species Legionella pneumophila [TaxId:272624] [189400] (1 PDB entry)
  8. 2491776Domain d3n1ua1: 3n1u A:4-183 [181818]
    Other proteins in same PDB: d3n1ua2
    automated match to d1j8da_
    complexed with ca

Details for d3n1ua1

PDB Entry: 3n1u (more details), 1.8 Å

PDB Description: structure of putative had superfamily (subfamily iii a) hydrolase from legionella pneumophila
PDB Compounds: (A:) Hydrolase, HAD superfamily, subfamily III A

SCOPe Domain Sequences for d3n1ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n1ua1 c.108.1.0 (A:4-183) automated matches {Legionella pneumophila [TaxId: 272624]}
nteiemnellekakkikclicdvdgvlsdgllhidnhgnelksfhvqdgmglkllmaagi
qvaiittaqnavvdhrmeqlgithyykgqvdkrsayqhlkktlglnddefayigddlpdl
pliqqvglgvavsnavpqvlefadwrtertggrgavrelcdlilnaqnkaelaitgylkq

SCOPe Domain Coordinates for d3n1ua1:

Click to download the PDB-style file with coordinates for d3n1ua1.
(The format of our PDB-style files is described here.)

Timeline for d3n1ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n1ua2