Lineage for d3n1te_ (3n1t E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929994Family d.13.1.0: automated matches [191614] (1 protein)
    not a true family
  6. 2929995Protein automated matches [191122] (10 species)
    not a true protein
  7. 2930008Species Escherichia coli [TaxId:562] [189487] (2 PDB entries)
  8. 2930019Domain d3n1te_: 3n1t E: [181816]
    automated match to d1xqua_
    complexed with 5gp; mutant

Details for d3n1te_

PDB Entry: 3n1t (more details), 1.72 Å

PDB Description: Crystal structure of the H101A mutant ecHint GMP complex
PDB Compounds: (E:) HIT-like protein hinT

SCOPe Domain Sequences for d3n1te_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n1te_ d.13.1.0 (E:) automated matches {Escherichia coli [TaxId: 562]}
etifskiirreipsdivyqddlvtafrdispqapthiliipniliptvndvsaeheqalg
rmitvaakiaeqegiaedgyrlimntnrhggqevyhiamhllggrplgpmla

SCOPe Domain Coordinates for d3n1te_:

Click to download the PDB-style file with coordinates for d3n1te_.
(The format of our PDB-style files is described here.)

Timeline for d3n1te_: