![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
![]() | Superfamily d.13.1: HIT-like [54197] (6 families) ![]() |
![]() | Family d.13.1.0: automated matches [191614] (1 protein) not a true family |
![]() | Protein automated matches [191122] (10 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [189487] (2 PDB entries) |
![]() | Domain d3n1te_: 3n1t E: [181816] automated match to d1xqua_ complexed with 5gp; mutant |
PDB Entry: 3n1t (more details), 1.72 Å
SCOPe Domain Sequences for d3n1te_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n1te_ d.13.1.0 (E:) automated matches {Escherichia coli [TaxId: 562]} etifskiirreipsdivyqddlvtafrdispqapthiliipniliptvndvsaeheqalg rmitvaakiaeqegiaedgyrlimntnrhggqevyhiamhllggrplgpmla
Timeline for d3n1te_: