Lineage for d3n1sm_ (3n1s M:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176031Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2176032Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 2176281Family d.13.1.0: automated matches [191614] (1 protein)
    not a true family
  6. 2176282Protein automated matches [191122] (9 species)
    not a true protein
  7. 2176295Species Escherichia coli [TaxId:562] [189487] (2 PDB entries)
  8. 2176302Domain d3n1sm_: 3n1s M: [181812]
    automated match to d1xqua_
    complexed with 5gp, edo

Details for d3n1sm_

PDB Entry: 3n1s (more details), 1.45 Å

PDB Description: Crystal structure of wild type ecHint GMP complex
PDB Compounds: (M:) HIT-like protein hinT

SCOPe Domain Sequences for d3n1sm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n1sm_ d.13.1.0 (M:) automated matches {Escherichia coli [TaxId: 562]}
aeetifskiirreipsdivyqddlvtafrdispqapthiliipniliptvndvsaeheqa
lgrmitvaakiaeqegiaedgyrlimntnrhggqevyhihmhllggrplgpmlah

SCOPe Domain Coordinates for d3n1sm_:

Click to download the PDB-style file with coordinates for d3n1sm_.
(The format of our PDB-style files is described here.)

Timeline for d3n1sm_: